PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G0677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family HB-other
Protein Properties Length: 1447aa    MW: 158639 Da    PI: 7.3319
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G0677genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.67.5e-0761117157
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                  +r+R  ++++ ++ ++++F  +  ++++e +e++++ g+t +qV+ +F  +R++ +k
  Gh_A08G0677  61 KRPRDLLNPKAVKYMQAVFSIKDAITKKESREISAQFGVTVTQVRDFFNSQRTRVRK 117
                  799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.64158118IPR001356Homeobox domain
SuperFamilySSF466891.63E-660122IPR009057Homeodomain-like
SMARTSM003895.2E-560122IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.6E-761128IPR009057Homeodomain-like
CDDcd000867.04E-661118No hitNo description
Gene3DG3DSA:1.20.930.106.3E-5218310IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476765.49E-5219309IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF1611111.57E-4710301250No hitNo description
TIGRFAMsTIGR012972.5E-8310311330IPR002524Cation efflux protein
Gene3DG3DSA:1.20.1510.102.7E-4610331248IPR027469Cation efflux protein transmembrane domain
PfamPF015452.4E-4410361249IPR002524Cation efflux protein
Gene3DG3DSA:3.30.70.13505.5E-2512501331IPR027470Cation efflux protein, cytoplasmic domain
SuperFamilySSF1602401.96E-1912521331No hitNo description
PfamPF169161.8E-2212541331IPR027470Cation efflux protein, cytoplasmic domain
Gene3DG3DSA:3.30.70.13505.3E-413581428IPR027470Cation efflux protein, cytoplasmic domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0006812Biological Processcation transport
GO:0055085Biological Processtransmembrane transport
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0008324Molecular Functioncation transmembrane transporter activity
Sequence ? help Back to Top
Protein Sequence    Length: 1447 aa     Download sequence    Send to blast
MDVLKENLAE LEIGSTVESI QKFIDIQREL FHSQIDQLQN VVVTQCKLTG VNPLAQEMVR  60
KRPRDLLNPK AVKYMQAVFS IKDAITKKES REISAQFGVT VTQVRDFFNS QRTRVRKQVR  120
LSREKALRSN ACEEAEDWVL PTGSEAVIPV EPVPLNSVGP VISEEAPSCS TQDDSLTGID  180
ELDKHFVENI FSKMHKEETF SGLVKLMEWI LQIQNPSVLY WFLNKGGVMI LATWLSQAAV  240
EEQTTVVLII LKVLSHLPLQ KALPEHMSAI LQSVNKLCLY RFSDISNRAR LLISRWSKMF  300
ARSQAAKKPN GLRSSTETQN EMLLKQSISE IMGDGSWQSN VYNSDGTLAT SNVRKESPQV  360
LKLLPASMDD SAKKNLLGVS SSHSRERRRV QLVEQPGQKV AGKNSQTTRT VPISQSRPMS  420
ADDIQKAKMR ALYMQSRHGK TGSSSNGMNE VKSEGLNKSS PSKASFSRPV SKVPSHPAEE  480
QKKPVVLPPK TSSRVETSLD PKQPVASKES PWEKCQKVKI PWHIPPEVKI NDLWSVGAGE  540
SSKEVHVQKN RNRRERETFY YTNQEIPSNP KEPWDREMDH DDSLTPEIPT EQPPDNETET  600
QVTHGEHFNG AATLEPSTSQ TGGAVSAEPD LELLAVLLKN PALVFALTSG QAGNLTSEET  660
VKLLDMIKAG GADTGKNVEE KVEVSLPSPT PSAIPGTSGW RPEAARNPFS QHSQMGNRVA  720
QASVGVVTPI PVAERLSATG MAAPQEEANG LSLAQQLAAA VAELLPQSNA TTLDKRHSPN  780
VAFSNRGHPS NLPASDIVLT MKKPSLVNSL TNSSAAAGPS MWVETMDGKT AAMSMALHIP  840
EKVHTSFSRS PLMPTLTQRQ TPAQLQPQVP HASDPYSTRP PVGNLGPMPD PWRGRQSLGS  900
NLYSQANQNN YNASSFGGSM HPQLRTDPPR EGKEYAELIG HHGKEIHLGI ETRTDREIDG  960
VTEDDDKAGL LPISAFGFRI PGFSSTVGVF YNDKKYLVFS DNPIYNIPRR WHLGHSNGHH  1020
DHDHNLTKEG EKIFRLGLGA DIGLATSKAL TGYLSGSTAI IADAAHSMSD VVLSGIALWS  1080
FKAANAPKDK EHPYGHGKFE TLGALGISCM LLATASGIAW HALELLIGLL STASEAVNGH  1140
SLVHGHSHHH GIDMDHPILA LNMTIIAICI KEGLYWITKR AGERQGSALM MANAWHHRAD  1200
AISSVVALIG VGGSILGVKF LDPLAGLVVS GMILKAGLET GYQSVLELVD AALPTEQLEP  1260
INQTILQVKG VKGCHRMRGR RAGSNLYLDV HIVVDPFSSV STAHGIGENV RHQIHKSHPE  1320
VTEVFIHIDP AYVEFSPDLM DQNEGLKTIT EQNSNMSVGE ENVQAIVSHL LSSKFPKKFK  1380
VERITQHTLQ GKMVLEVEVT MPPDIMIREA MDTAKEAEKE IMKAASNIVL VNLQLRLGRP  1440
IPQFRYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3h90_A4e-221048133320282Ferrous-iron efflux pump fieF
3h90_B4e-221048133320282Ferrous-iron efflux pump fieF
3h90_C4e-221048133320282Ferrous-iron efflux pump fieF
3h90_D4e-221048133320282Ferrous-iron efflux pump fieF
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.144080.0ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012474033.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
TrEMBLA0A0B0NNT50.0A0A0B0NNT5_G
STRINGPOPTR_0002s20990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-160HB-other family protein